General Information

  • ID:  hor006720
  • Uniprot ID:  P13152
  • Protein name:  Glycoprotein hormones alpha chain 1
  • Gene name:  cgaa
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YQNSDMTNVGCEECKLKENKVFSNPGAPVYQCTGCCFSRAYPTPLQSKKAMLVPKNITSEATCCVAKEGERVVVDNIKLTNHTECWCNTCYHHKS
  • Length:  95(14-108)
  • Propeptide:  SLILSILLYMADSYQNSDMTNVGCEECKLKENKVFSNPGAPVYQCTGCCFSRAYPTPLQSKKAMLVPKNITSEATCCVAKEGERVVVDNIKLTNHTECWCNTCYHHKS
  • Signal peptide:  SLILSILLYMADS
  • Modification:  NA
  • Glycosylation:  T56 N-linked (GlcNAc...) asparagine;T81 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Involved in gametogenesis and steroidogenesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  11-35; 14-64; 32-85; 36-87; 63-90
  • Structure ID:  AF-P13152-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006720_AF2.pdbhor006720_ESM.pdb

Physical Information

Mass: 1230299 Formula: C453H714N128O143S12
Absent amino acids: Common amino acids: CK
pI: 7.88 Basic residues: 14
Polar residues: 40 Hydrophobic residues: 22
Hydrophobicity: -51.16 Boman Index: -16970
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 54.32
Instability Index: 4809.68 Extinction Coefficient cystines: 12085
Absorbance 280nm: 128.56

Literature

  • PubMed ID:  2466605
  • Title:  Primary structure of two mRNAs encoding putative salmon alpha-subunits of pituitary glycoprotein hormone.